PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013609805.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 369aa    MW: 41904.6 Da    PI: 6.6239
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013609805.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
   XP_013609805.1 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding51.52.3e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+++eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
   XP_013609805.1  67 RGRFSPEEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466891.12E-2911108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001672.39E-111761No hitNo description
PROSITE profilePS5129425.2762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.6E-2565116IPR009057Homeodomain-like
SMARTSM007173.9E-1666114IPR001005SANT/Myb domain
PfamPF002494.3E-1567111IPR001005SANT/Myb domain
CDDcd001671.68E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF SPEEEKLIIS LHGVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPH  120
HHYNRHQPSI TTVTMNVDAT STGTAVPSTT TNTSTIDNLH FDSFMNSPNQ LNFTNDQEAN  180
TKIQETLFSH KTPLFMVDQT LPVLEGMFSQ NIITNNNKKN NYHDTRRGGR GGVLEQSFLT  240
NNTEEWDMNL SQQEPFQVPT MVSHLFNNST SSNTETVISY NLPALVEGNV DNISPLGNSA  300
QDGDMASTIE CLKKQELSYD QWIDSQQCSN FFLWDNLNIN VEGSSLVGNQ DPSMTLESSA  360
LSSSFPSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2141160.0AF214116.2 Arabidopsis thaliana putative transcription factor (MYB103) mRNA, complete cds.
GenBankAY5195640.0AY519564.1 Arabidopsis thaliana MYB transcription factor (At1g63910) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013691445.10.0PREDICTED: transcription factor MYB46-like
RefseqXP_013609805.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A078F9900.0A0A078F990_BRANA; BnaC09g12530D protein
TrEMBLA0A0D3E4F40.0A0A0D3E4F4_BRAOL; Uncharacterized protein
STRINGBra027771.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87602539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.10.0myb domain protein 103